PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 341aa    MW: 37974.5 Da    PI: 6.1811
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618115.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21.1e-051143436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    + C+ ++   ++ fC+ ++ +lC  C  ++H  
  XP_009618115.1 11 KLCDSCKTTSATVFCRADSAFLCLACDCKIHAA 43
                    68******99*****************999954 PP

2zf-B_box25.43e-085395339
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                     ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  XP_009618115.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHER 95
                    689*****************************65777777776 PP

3CCT69.96.6e-24278321144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_009618115.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.997855IPR000315B-box-type zinc finger
SMARTSM003362.3E-9855IPR000315B-box-type zinc finger
CDDcd000218.01E-71255No hitNo description
PROSITE profilePS5011910.5945198IPR000315B-box-type zinc finger
PfamPF006432.0E-65397IPR000315B-box-type zinc finger
CDDcd000217.92E-95498No hitNo description
SMARTSM003361.6E-105698IPR000315B-box-type zinc finger
PfamPF062035.0E-18278320IPR010402CCT domain
PROSITE profilePS5101716.787278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGSENWSLTV KLCDSCKTTS ATVFCRADSA FLCLACDCKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERFPVVP FYDSAVAKSH GVNDEEKYFD  120
SHENNPQPEE EAEAASWILP TPKEGTDNQY KSADYLFNDM DSYLDMDIMS CDQKPHNILQ  180
LHQQYSSDGV VPVQKKNENN HLQGPVVDGF PTYEMDFIGS KPYLYNFNSQ SISQSVSSSS  240
MDVGVVPEHS AMADVSNTLV MNSSADAGVP NPVSGLDREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TEIEVDSLLA ADASYGVVPS F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590370.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_009618115.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016463845.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-103COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLK4DHC30.0K4DHC3_SOLLC; Uncharacterized protein
STRINGSolyc12g096500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-100CONSTANS-like 4